Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NIR2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16904320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16904320 20 μL
NBP169043 100 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16904320 Supplier Novus Biologicals Supplier No. NBP16904320UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

NIR2 Polyclonal specifically detects NIR2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen NIR2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O35954
Gene Alias DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1
Gene Symbols PITPNM1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSA
Molecular Weight of Antigen 135 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 9600
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.