Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NKD1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15526920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15526920 20 μL
NBP155269 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15526920 Supplier Novus Biologicals Supplier No. NBP15526920UL

Rabbit Polyclonal Antibody

NKD1 Polyclonal specifically detects NKD1 in Human samples. It is validated for Western Blot.

Specifications

Antigen NKD1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q969G9
Gene Alias Dvl-binding protein, hNkd, hNkd1, naked cuticle homolog 1 (Drosophila), naked cuticle-1, naked-1, Naked1, NKD, protein naked cuticle homolog 1
Gene Symbols NKD1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NKD1(naked cuticle homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of NKD1. Peptide sequence LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ.
Molecular Weight of Antigen 52 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 85407
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.