Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NKD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15526920UL
Description
NKD1 Polyclonal specifically detects NKD1 in Human samples. It is validated for Western Blot.Specifications
NKD1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q969G9 | |
NKD1 | |
Synthetic peptides corresponding to NKD1(naked cuticle homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of NKD1. Peptide sequence LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ. | |
Affinity Purified | |
RUO | |
85407 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Dvl-binding protein, hNkd, hNkd1, naked cuticle homolog 1 (Drosophila), naked cuticle-1, naked-1, Naked1, NKD, protein naked cuticle homolog 1 | |
Rabbit | |
52 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction