Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NKD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
Antigen | NKD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15526920
![]() |
Novus Biologicals
NBP15526920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP155269
![]() |
Novus Biologicals
NBP155269 |
100 μL |
Each for $501.50
|
|
|||||
Description
NKD1 Polyclonal specifically detects NKD1 in Human samples. It is validated for Western Blot.Specifications
NKD1 | |
Polyclonal | |
Rabbit | |
Q969G9 | |
85407 | |
Synthetic peptides corresponding to NKD1(naked cuticle homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of NKD1. Peptide sequence LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Dvl-binding protein, hNkd, hNkd1, naked cuticle homolog 1 (Drosophila), naked cuticle-1, naked-1, Naked1, NKD, protein naked cuticle homolog 1 | |
NKD1 | |
IgG | |
52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title