Invitrogen™ NKG2D (CD314) Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579570

Catalog No. PIPA579570

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lymph tissue, rat spleen tissue, mouse thymus tissue.

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. NK cells can regulate specific humoral and cell-mediated immunity, and preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NK gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells.

Specifications

• Antigen: NKG2D (CD314)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Klrk1
• Gene Alias: CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22914, 24934, 27007
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and 0.05 mg sodium azide
• Gene Accession No.: O54709, O70215, P26718
• Gene Symbols: Klrk1
• Immunogen: A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG