NKp46/NCR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258055

Catalog No. NBP258055

Description

NKp46/NCR1 Polyclonal specifically detects NKp46/NCR1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NKp46/NCR1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46FLJ99094, NK-p46lymphocyte antigen 94 (mouse) homolog (activating NK-receptor; NK-p46)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NCR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT
• Quantity: 100 μL
• Research Discipline: Innate Immunity
• Gene ID (Entrez): 9437
• Target Species: Human
• Isotype: IgG

For Research Use Only