NKX2.3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31040625UL

Catalog No. NB125714

Description

NKX2.3 Polyclonal specifically detects NKX2.3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NKX2.3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: CSX3NK2.3, Homeobox protein NK-2 homolog C, homeobox protein Nkx-2.3, NK2 transcription factor related, locus 3 (Drosophila), NKX2.3, NKX23, NKX2CNK-2 (Drosophila) homolog C, NKX4-3
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse NKX2.3 (NP_032725). Peptide sequence AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 159296
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.