Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NKX2.3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | NKX2.3 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NKX2.3 Polyclonal specifically detects NKX2.3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NKX2.3 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Mouse | |
CSX3NK2.3, Homeobox protein NK-2 homolog C, homeobox protein Nkx-2.3, NK2 transcription factor related, locus 3 (Drosophila), NKX2.3, NKX23, NKX2CNK-2 (Drosophila) homolog C, NKX4-3 | |
The immunogen is a synthetic peptide directed towards the c terminal region of mouse NKX2.3 (NP_032725). Peptide sequence AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
159296 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title