Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
nkx6.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$106.19 - $320.71
Specifications
| Antigen | nkx6.2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Format | Purified |
Description
nkx6.2 Polyclonal specifically detects nkx6.2 in Human samples. It is validated for Western Blot.Specifications
| nkx6.2 | |
| Western Blot | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 84504 | |
| Polyclonal | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Unconjugated | |
| Rabbit | |
| Human | |
| GTXhomeobox 6B, Homeobox protein NK-6 homolog B, homeobox protein Nkx-6.2, MGC126684, NK homeobox family 6, B, NK6 homeobox 2, NK6 transcription factor related, locus 2, NK6 transcription factor related, locus 2 (Drosophila), NKX6.1, NKX6.2, NKX6Bglial and testis-specific homeobox protein | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human nkx6.2 (NP_796374). Peptide sequence PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title