Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
nkx6.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | nkx6.2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
nkx6.2 Polyclonal specifically detects nkx6.2 in Human samples. It is validated for Western Blot.Specifications
nkx6.2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
GTXhomeobox 6B, Homeobox protein NK-6 homolog B, homeobox protein Nkx-6.2, MGC126684, NK homeobox family 6, B, NK6 homeobox 2, NK6 transcription factor related, locus 2, NK6 transcription factor related, locus 2 (Drosophila), NKX6.1, NKX6.2, NKX6Bglial and testis-specific homeobox protein | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human nkx6.2 (NP_796374). Peptide sequence PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
84504 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title