Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
nkx6.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | nkx6.2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
nkx6.2 Polyclonal specifically detects nkx6.2 in Human samples. It is validated for Western Blot.Specifications
| nkx6.2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| GTXhomeobox 6B, Homeobox protein NK-6 homolog B, homeobox protein Nkx-6.2, MGC126684, NK homeobox family 6, B, NK6 homeobox 2, NK6 transcription factor related, locus 2, NK6 transcription factor related, locus 2 (Drosophila), NKX6.1, NKX6.2, NKX6Bglial and testis-specific homeobox protein | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human nkx6.2 (NP_796374). Peptide sequence PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 84504 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title