Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZSCAN5B Antibody, Novus Biologicals™

ZSCAN5B Antibody, Novus Biologicals™
SDP

Catalog No. NBP191411 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191411 100 μL
NBP191420UL 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP191411 Supplier Novus Biologicals Supplier No. NBP191411
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZSCAN5B Polyclonal specifically detects ZSCAN5B in Human samples. It is validated for Western Blot.

Specifications

Antigen ZSCAN5B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias zinc finger and SCAN domain containing 5B, zinc finger and SCAN domain-containing protein 5B, ZNF495B
Gene Symbols ZSCAN5B
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human hCG_2042202. Peptide sequence HKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQ.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 342933
Test Specificity Expected identity based on immunogen sequence: Human: 100;%Mouse: 100%; Rat: 100%; Bovine: 92%; Florida lancelet: 92%; Short-tailed field vole: 92%; Crab-eating macaque: 92%; Sumatran orangutan: 92%; Xenopus: 91%; Western clawed frog: 91%; Zebrafish: 91%; Green puffer: 91%; Rainbow smelt: 91%; Chicken: 91%; Onchocerca volvulus: 85%; Canine: 84%; Fruit fly: 84%; Bornean orangutan: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Red-chested mustached tamarin: 84%; Western Gorilla: 84%; Common woolly monkey: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.