NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191426

Catalog No. NBP191426

Description

TNRC18B Polyclonal specifically detects TNRC18B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TNRC18B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: AAI31809
• Gene Symbols: TNRC18
• Immunogen: Synthetic peptide directed towards the N terminal of human TNRC18. Peptide sequence GKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVER.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27320
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: TNRC18, TNRC18B, TNRC18P2 trinucleotide repeat containing 18 pseudogene 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.