Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody
$464.00
Specifications
| Antigen | TNRC18B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TNRC18B Polyclonal specifically detects TNRC18B in Human samples. It is validated for Western Blot.Specifications
| TNRC18B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| TNRC18, TNRC18B, TNRC18P2 trinucleotide repeat containing 18 pseudogene 2 | |
| TNRC18 | |
| IgG | |
| Affinity Purified | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AAI31809 | |
| 27320 | |
| Synthetic peptide directed towards the N terminal of human TNRC18. Peptide sequence GKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVER. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title