Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

P2X2/P2RX2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP182393 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182393 100 μL
NBP18239320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP182393 Supplier Novus Biologicals Supplier No. NBP182393
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

P2X2/P2RX2 Polyclonal specifically detects P2X2/P2RX2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen P2X2/P2RX2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001158306
Gene Alias ATP receptor, MGC129601, P2X purinoceptor 2, P2X2P2X Receptor, subunit 2, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 2
Gene Symbols P2RX2
Host Species Rabbit
Immunogen Synthetic peptide towards P2X2. Peptide sequence EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22953
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.