MCM10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182395

Catalog No. NBP182395

Description

MCM10 Polyclonal specifically detects MCM10 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: MCM10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CNA43homolog of yeast MCM10, DNA43, hsMCM10, MCM10 minichromosome maintenance deficient 10, MCM10 minichromosome maintenance deficient 10 (S. cerevisiae), MGC126776, minichromosome maintenance complex component 10, PRO2249, protein MCM10 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 98 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_081566
• Gene Symbols: MCM10
• Immunogen: Synthetic peptide towards Mcm10. Peptide sequence DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55388
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG