CLMN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191450

Catalog No. NBP191450

Description

CLMN Polyclonal specifically detects CLMN in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CLMN
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calmin, calmin (calponin-like, transmembrane), calponin like transmembrane domain protein, calponin-like transmembrane domain protein, FLJ12383, FLJ43048, KIAA1188
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79789
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_079010
• Gene Symbols: CLMN
• Immunogen: Synthetic peptide directed towards the C terminal of human CLMN. Peptide sequence LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 76%; Canine: 76%; Mouse: 76%.
• Target Species: Human, Mouse, Pig, Bovine, Canine, Yeast
• Isotype: IgG