Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLMN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CLMN |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CLMN Polyclonal specifically detects CLMN in Human samples. It is validated for Western Blot.Specifications
CLMN | |
Polyclonal | |
Rabbit | |
NP_079010 | |
79789 | |
Synthetic peptide directed towards the C terminal of human CLMN. Peptide sequence LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
calmin, calmin (calponin-like, transmembrane), calponin like transmembrane domain protein, calponin-like transmembrane domain protein, FLJ12383, FLJ43048, KIAA1188 | |
CLMN | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title