Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC37A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19147420UL
Description
LRRC37A3 Polyclonal specifically detects LRRC37A3 in Human samples. It is validated for Western Blot.Specifications
LRRC37A3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_955372 | |
LRRC37A3 | |
Synthetic peptide directed towards the middle region of human LRRC37A3. Peptide sequence NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ34306, KIAA0563, leucine rich repeat containing 37, member A3, leucine-rich repeat-containing protein 37A3, LRRC37A, MGC41826, MGC57168 | |
Rabbit | |
Affinity Purified | |
RUO | |
374819 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction