PSMC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191476

Catalog No. NBP191476

Description

PSMC1 Polyclonal specifically detects PSMC1 in Mouse samples. It is validated for Western Blot, Simple Western.

Specifications

• Antigen: PSMC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Simple Western
• Gene Accession No.: P62192
• Gene Symbols: PSMC1
• Immunogen: Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5700
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.