Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PSMC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191476
|
Novus Biologicals
NBP191476 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19147620
|
Novus Biologicals
NBP19147620UL |
20 μL | N/A | N/A | N/A | ||||
Description
PSMC1 Polyclonal specifically detects PSMC1 in Mouse samples. It is validated for Western Blot, Simple Western.Specifications
| PSMC1 | |
| Polyclonal | |
| Rabbit | |
| P62192 | |
| 5700 | |
| Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541 | |
| PSMC1 | |
| IgG | |
| 48 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title