Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19147620UL
Description
PSMC1 Polyclonal specifically detects PSMC1 in Mouse samples. It is validated for Western Blot, Simple Western.Specifications
PSMC1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P62192 | |
PSMC1 | |
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. | |
Affinity Purified | |
RUO | |
5700 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541 | |
Rabbit | |
48 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction