Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Melanoma antigen family E1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19148920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19148920 20 μL
NBP191489 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19148920 Supplier Novus Biologicals Supplier No. NBP19148920UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

Melanoma antigen family E1 Polyclonal specifically detects Melanoma antigen family E1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Melanoma antigen family E1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_444431
Gene Alias Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1
Gene Symbols MAGEE1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE.
Molecular Weight of Antigen 80 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57692
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.