OTUD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191498

Catalog No. NBP191498

Description

OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OTUD6A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DUBA2, DUBA-2, OTU domain containing 6A
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: NP_997203
• Gene Symbols: OTUD6A
• Immunogen: Synthetic peptide directed towards the middle region of human OTUD6A. Peptide sequence KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 139562
• Target Species: Human
• Isotype: IgG