Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTUD6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | OTUD6A |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19149820
|
Novus Biologicals
NBP19149820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191498
|
Novus Biologicals
NBP191498 |
100 μL |
Each for $499.50
|
|
|||||
Description
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.Specifications
| OTUD6A | |
| Unconjugated | |
| RUO | |
| NP_997203 | |
| 139562 | |
| Synthetic peptide directed towards the middle region of human OTUD6A. Peptide sequence KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Human | |
| DUBA2, DUBA-2, OTU domain containing 6A | |
| OTUD6A | |
| IgG | |
| 32 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title