Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTUD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19149820UL
Description
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.Specifications
| OTUD6A | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_997203 | |
| OTUD6A | |
| Synthetic peptide directed towards the middle region of human OTUD6A. Peptide sequence KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE. | |
| Affinity Purified | |
| RUO | |
| 139562 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DUBA2, DUBA-2, OTU domain containing 6A | |
| Rabbit | |
| 32 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction