Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C9orf64 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C9orf64 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C9orf64 Polyclonal specifically detects C9orf64 in Human samples. It is validated for Western Blot.Specifications
C9orf64 | |
Polyclonal | |
Rabbit | |
NP_115683 | |
84267 | |
Synthetic peptide directed towards the C terminal of human C9orf64. Peptide sequence EMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 9 open reading frame 64, hypothetical protein LOC84267, RP11-575L7.5 | |
C9ORF64 | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title