FAM161A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191508

Catalog No. NBP191508

Description

FAM161A Polyclonal specifically detects FAM161A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM161A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: family with sequence similarity 161, member A, RP28
• Host Species: Rabbit
• Molecular Weight of Antigen: 65 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 92%; Rabbit: 85%; Dog: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115556
• Gene Symbols: FAM161A
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence: RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84140
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.