Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM161A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | FAM161A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM161A Polyclonal specifically detects FAM161A in Human samples. It is validated for Western Blot.Specifications
FAM161A | |
Polyclonal | |
Rabbit | |
NP_115556 | |
84140 | |
The specific Immunogen is proprietary information. Peptide sequence: RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 161, member A, RP28 | |
FAM161A | |
IgG | |
65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title