Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZNF845 Antibody, Novus Biologicals™

ZNF845 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19153020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19153020 20 μL
NBP191530 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19153020 Supplier Novus Biologicals Supplier No. NBP19153020UL

Description

Rabbit Polyclonal Antibody

ZNF845 Polyclonal specifically detects ZNF845 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF845
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias zinc finger protein 845
Gene Symbols ZNF845
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human LOC91664. Peptide sequence YKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 91664
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.