Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCF23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19153320UL
Description
TCF23 Polyclonal specifically detects TCF23 in Mouse samples. It is validated for Western Blot.Specifications
TCF23 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_444315 | |
TCF23 | |
Synthetic peptide directed towards the C terminal of mouse TCF23. Peptide sequence PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF. | |
Protein A purified | |
RUO | |
150921 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BHLHA24, class A basic helix-loop-helix protein 24, class II basic helix-loop-helix protein TCF23, TCF-23, transcription factor 23 | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction