Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCF23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TCF23 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191533
|
Novus Biologicals
NBP191533 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19153320
|
Novus Biologicals
NBP19153320UL |
20 μL | N/A | N/A | N/A | ||||
Description
TCF23 Polyclonal specifically detects TCF23 in Mouse samples. It is validated for Western Blot.Specifications
| TCF23 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_444315 | |
| 150921 | |
| Synthetic peptide directed towards the C terminal of mouse TCF23. Peptide sequence PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF. | |
| Primary | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| BHLHA24, class A basic helix-loop-helix protein 24, class II basic helix-loop-helix protein TCF23, TCF-23, transcription factor 23 | |
| TCF23 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title