Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TTC19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP191534 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191534 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191534 Supplier Novus Biologicals Supplier No. NBP191534
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TTC19 Polyclonal specifically detects TTC19 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen TTC19
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_082636
Gene Alias MGC138312, MGC19520, tetratricopeptide repeat domain 19,2010204O13Rik, tetratricopeptide repeat protein 19, mitochondrial, TPR repeat protein 19
Gene Symbols TTC19
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of mouse TTC19. Peptide sequence RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ.
Molecular Weight of Antigen 39 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54902
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Mouse, Rat, Yeast
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.