Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TTC19 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen TTC19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP191534
SDP
View Documents
Novus Biologicals
NBP191534
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

TTC19 Polyclonal specifically detects TTC19 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

TTC19
Polyclonal
Purified
RUO
MGC138312, MGC19520, tetratricopeptide repeat domain 19,2010204O13Rik, tetratricopeptide repeat protein 19, mitochondrial, TPR repeat protein 19
TTC19
IgG
Protein A purified
Western Blot
Unconjugated
Rabbit
NP_082636
54902
Synthetic peptide directed towards the N terminal of mouse TTC19. Peptide sequence RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ.
Primary
39 kDa
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.