Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Use1/UBE2Z Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Use1/UBE2Z |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
Use1/UBE2Z Polyclonal specifically detects Use1/UBE2Z in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Use1/UBE2Z | |
Polyclonal | |
Purified | |
RUO | |
MDS032, P31, protein p31, putative MAPK activating protein PM26, Putative MAPK-activating protein PM26, Q-SNARE, SLT1, SNARE-like tail-anchored protein 1 homolog, unconventional SNARE in the ER 1 homolog (S. cerevisiae), USE1L, USE1-like protein, vesicle transport protein USE1 | |
USE1 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
NP_080193 | |
55850 | |
Synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Peptide sequence MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title