NRSF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182399

Catalog No. NBP182399

Description

NRSF Polyclonal specifically detects NRSF in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: NRSF
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Neural-restrictive silencer factor, NRSFneuron restrictive silencer factor, RE1-silencing transcription factor, X2 box repressor, XBRrepressor binding to the X2 box
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5978
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: NP_035393
• Gene Symbols: REST
• Immunogen: Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Mouse: 92%; Bovine: 85%; Pig: 85%; Xenopus: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG