Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRSF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | NRSF |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP182399
![]() |
Novus Biologicals
NBP182399 |
100 μL |
Each for $480.74
|
|
|||||
NBP18239920
![]() |
Novus Biologicals
NBP18239920UL |
20 μL | N/A | N/A | N/A | ||||
Description
NRSF Polyclonal specifically detects NRSF in Mouse samples. It is validated for Western Blot.Specifications
| NRSF | |
| Unconjugated | |
| RUO | |
| Neural-restrictive silencer factor, NRSFneuron restrictive silencer factor, RE1-silencing transcription factor, X2 box repressor, XBRrepressor binding to the X2 box | |
| REST | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_035393 | |
| 5978 | |
| Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title