Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KLF3 Antibody, Novus Biologicals™

KLF3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18240320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18240320 20 μL
NBP182403 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18240320 Supplier Novus Biologicals Supplier No. NBP18240320UL

Description

Rabbit Polyclonal Antibody

KLF3 Polyclonal specifically detects KLF3 in Rat samples. It is validated for Western Blot.

Specifications

Antigen KLF3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_001099212
Gene Alias Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
Gene Symbols KLF3
Host Species Rabbit
Immunogen Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51274
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.