Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KLHL12/C3IP1 Antibody, Novus Biologicals™

KLHL12/C3IP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP182404 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182404 100 μL
NBP18240420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP182404 Supplier Novus Biologicals Supplier No. NBP182404
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KLHL12/C3IP1 Polyclonal specifically detects KLHL12/C3IP1 in Rat samples. It is validated for Western Blot.

Specifications

Antigen KLHL12/C3IP1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_714952
Gene Alias C3IP1kelch-like protein 12, CUL3-interacting protein 1, DKIR, FLJ27152, kelch-like 12 (Drosophila), kelch-like protein C3IP1
Gene Symbols KLHL12
Host Species Rabbit
Immunogen Synthetic peptide towards C3IP1. Peptide sequence DIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYF.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 59349
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.