Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHL12/C3IP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18240420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18240420 20 μL
NBP182404 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18240420 Supplier Novus Biologicals Supplier No. NBP18240420UL

Rabbit Polyclonal Antibody

KLHL12/C3IP1 Polyclonal specifically detects KLHL12/C3IP1 in Rat samples. It is validated for Western Blot.

Specifications

Antigen KLHL12/C3IP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_714952
Gene Alias C3IP1kelch-like protein 12, CUL3-interacting protein 1, DKIR, FLJ27152, kelch-like 12 (Drosophila), kelch-like protein C3IP1
Gene Symbols KLHL12
Host Species Rabbit
Immunogen Synthetic peptide towards C3IP1. Peptide sequence DIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 59349
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.