Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mohawk homeobox Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18240820UL
Description
Mohawk homeobox Polyclonal specifically detects Mohawk homeobox in Mouse samples. It is validated for Western Blot.Specifications
Mohawk homeobox | |
Polyclonal | |
Western Blot 1:1000 | |
NP_808263 | |
MKX | |
Synthetic peptide towards mohawk homebox. Peptide sequence GDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQGTTTSCIIQKSSH. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C10orf48, homeobox protein Mohawk, IFRX, Iroquois family related homeodomain protein, iroquois homeobox protein-like 1, IRXL1chromosome 10 open reading frame 48, MGC39616, mohawk homeobox | |
Rabbit | |
Affinity Purified | |
RUO | |
283078 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction