Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mohawk homeobox Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Mohawk homeobox |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18240820
|
Novus Biologicals
NBP18240820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP182408
|
Novus Biologicals
NBP182408 |
100 μL |
Each for $487.50
|
|
|||||
Description
Mohawk homeobox Polyclonal specifically detects Mohawk homeobox in Mouse samples. It is validated for Western Blot.Specifications
| Mohawk homeobox | |
| Polyclonal | |
| Rabbit | |
| NP_808263 | |
| 283078 | |
| Synthetic peptide towards mohawk homebox. Peptide sequence GDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQGTTTSCIIQKSSH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C10orf48, homeobox protein Mohawk, IFRX, Iroquois family related homeodomain protein, iroquois homeobox protein-like 1, IRXL1chromosome 10 open reading frame 48, MGC39616, mohawk homeobox | |
| MKX | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title