Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM63B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP19155520UL

View more versions of this product

Catalog No. NBP19155520

$158.00 / Each of 1

Qty

Add to Cart

Description

TMEM63B Polyclonal specifically detects TMEM63B in Human samples. It is validated for Western Blot.

Specifications

Antigen	TMEM63B
Classification	Polyclonal
Dilution	Western Blot 1:1000
Gene Accession No.	NP_060896
Gene Symbols	TMEM63B
Immunogen	Synthetic peptide directed towards the middle region of human TMEM63B. Peptide sequence VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS & 2% Sucrose. with No Preservative
Gene Alias	transmembrane protein 63B
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	55362
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

TMEM63B Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions