Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM63B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | TMEM63B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19155520
![]() |
Novus Biologicals
NBP19155520UL |
20 μL |
Each for $158.00
|
|
|||||
NBP191555
![]() |
Novus Biologicals
NBP191555 |
100 μL |
Each for $487.50
|
|
|||||
Description
TMEM63B Polyclonal specifically detects TMEM63B in Human samples. It is validated for Western Blot.Specifications
TMEM63B | |
Polyclonal | |
Rabbit | |
NP_060896 | |
55362 | |
Synthetic peptide directed towards the middle region of human TMEM63B. Peptide sequence VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
transmembrane protein 63B | |
TMEM63B | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title