PRSS16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191559

Catalog No. NBP191559

Description

PRSS16 Polyclonal specifically detects PRSS16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PRSS16
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ36271, FLJ44172, protease, serine, 16 (thymus), thymus specific serine peptidase, thymus-specific serine protease
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10279
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005856
• Gene Symbols: PRSS16
• Immunogen: Synthetic peptide directed towards the middle region of human PRSS16. Peptide sequence SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Equine: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%; Guinea pig: 84%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG