Galectin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191560

Catalog No. NBP191560

Description

Galectin-4 Polyclonal specifically detects Galectin-4 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Galectin-4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Antigen NY-CO-27, gal-4, GAL4, galectin 4, galectin-4, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, lectin, galactoside-binding, soluble, 4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3960
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_034836
• Gene Symbols: LGALS4
• Immunogen: Synthetic peptide directed towards the C terminal of human Lgals4. Peptide sequence VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Rabbit: 92%; Canine: 85%; Equine: 85%; Xenopus: 84%; Guinea pig: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG