Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Galectin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Galectin-4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Galectin-4 Polyclonal specifically detects Galectin-4 in Mouse samples. It is validated for Western Blot.Specifications
Galectin-4 | |
Polyclonal | |
Rabbit | |
NP_034836 | |
3960 | |
Synthetic peptide directed towards the C terminal of human Lgals4. Peptide sequence VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Antigen NY-CO-27, gal-4, GAL4, galectin 4, galectin-4, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, lectin, galactoside-binding, soluble, 4 | |
LGALS4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title