Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM171A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19158220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19158220 20 μL
NBP191582 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19158220 Supplier Novus Biologicals Supplier No. NBP19158220UL

Rabbit Polyclonal Antibody

FAM171A1 Polyclonal specifically detects FAM171A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen FAM171A1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001010924
Gene Alias family with sequence similarity 171, member A1, MGC130014, MGC130015
Gene Symbols FAM171A1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human C10orf38. Peptide sequence ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 221061
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.