NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191590

Catalog No. NBP191590

Description

MFSD12 Polyclonal specifically detects MFSD12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MFSD12
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_068377
• Gene Symbols: MFSD12
• Immunogen: Synthetic peptide directed towards the N terminal of human C19orf28. Peptide sequence MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C19orf28, chromosome 19 open reading frame 28, hypothetical protein LOC126321, major facilitator superfamily domain containing 12, MGC20700, PP3501
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126321
• Target Species: Human, Guinea Pig, Rabbit
• Isotype: IgG