Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFSD12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19159120UL
Description
MFSD12 Polyclonal specifically detects MFSD12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MFSD12 | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
NP_001036145 | |
MFSD12 | |
Synthetic peptide directed towards the middle region of human C19orf28. Peptide sequence VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C19orf28, chromosome 19 open reading frame 28, hypothetical protein LOC126321, major facilitator superfamily domain containing 12, MGC20700, PP3501 | |
Rabbit | |
Affinity Purified | |
RUO | |
126321 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction