Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MFSD12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	MFSD12
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1915920 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19159120UL	20 μL	Each for $206.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP191591 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP191591	100 μL	Each for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

MFSD12 Polyclonal specifically detects MFSD12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	MFSD12
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	C19orf28, chromosome 19 open reading frame 28, hypothetical protein LOC126321, major facilitator superfamily domain containing 12, MGC20700, PP3501
Gene Symbols	MFSD12
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_001036145
Gene ID (Entrez)	126321
Immunogen	Synthetic peptide directed towards the middle region of human C19orf28. Peptide sequence VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MFSD12 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents