Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM171A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM171A1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191582
![]() |
Novus Biologicals
NBP191582 |
100 μL |
Each for $487.50
|
|
|||||
NBP19158220
![]() |
Novus Biologicals
NBP19158220UL |
20 μL | N/A | N/A | N/A | ||||
Description
FAM171A1 Polyclonal specifically detects FAM171A1 in Human samples. It is validated for Western Blot.Specifications
FAM171A1 | |
Polyclonal | |
Rabbit | |
NP_001010924 | |
221061 | |
Synthetic peptide directed towards the middle region of human C10orf38. Peptide sequence ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 171, member A1, MGC130014, MGC130015 | |
FAM171A1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title