Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCORL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191618
Description
LCORL Polyclonal specifically detects LCORL in Human, Bovine samples. It is validated for Western Blot.Specifications
LCORL | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ30696, LCoR-like protein, ligand dependent nuclear receptor corepressor-like, ligand-dependent nuclear receptor corepressor-like protein, MLR1MBLK1-related protein, transcription factor MLR1 | |
Rabbit | |
Protein A purified | |
RUO | |
254251 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_742165 | |
LCORL | |
Synthetic peptide directed towards the C terminal of human A830039H10RIK. Peptide sequence EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Chicken: 100%; Zebrafish: 85%; Green puffer: 85%; Bovine: 78%. | |
Human, Bovine, Rat, Canine, Equine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction