LCORL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191618

Catalog No. NBP191618

Description

LCORL Polyclonal specifically detects LCORL in Human, Bovine samples. It is validated for Western Blot.

Specifications

• Antigen: LCORL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ30696, LCoR-like protein, ligand dependent nuclear receptor corepressor-like, ligand-dependent nuclear receptor corepressor-like protein, MLR1MBLK1-related protein, transcription factor MLR1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 254251
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_742165
• Gene Symbols: LCORL
• Immunogen: Synthetic peptide directed towards the C terminal of human A830039H10RIK. Peptide sequence EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Chicken: 100%; Zebrafish: 85%; Green puffer: 85%; Bovine: 78%.
• Target Species: Human, Bovine, Rat, Canine, Equine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified